General Information

  • ID:  hor004366
  • Uniprot ID:  P01289
  • Protein name:  Neuropeptide K
  • Gene name:  TAC1
  • Organism:  Bos taurus (Bovine)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031835 substance P receptor binding
  • GO BP:  GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0019233 sensory perception of pain; GO:0048265 response to pain
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0043025 neuronal cell body; GO:0045202 synapse

Sequence Information

  • Sequence:  DADSSIEKQVALLKALYGHGQLSHKRHKTDSFVGLM
  • Length:  36
  • Propeptide:  MKILVAVAVIFFISTQLSAEEIGANDDFNYWSDWSDSDQIKEEMPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQLSHKRHKTDSFVGLMGKRALNSVAYERSVMQDYERRRK
  • Signal peptide:  MKILVAVAVIFFISTQLSA
  • Modification:  T36 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TACR1, TACR2
  • Target Unid:  F1MIX5, P05363
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06303-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P06303-F1.pdbhor004366_AF2.pdbhor004366_ESM.pdb

Physical Information

Mass: 460604 Formula: C175H283N51O53S
Absent amino acids: CNPW Common amino acids: L
pI: 9.2 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -41.94 Boman Index: -6028
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 89.44
Instability Index: 5770.83 Extinction Coefficient cystines: 1490
Absorbance 280nm: 42.57

Literature

  • PubMed ID:  NA
  • Title:  NA